Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 4
LigandBDBM81766
Substrate/Competitorn/a
Ki 7.3±n/a nM
CommentsPDSP_1242
Citation Reisine, TBell, GI Molecular biology of somatostatin receptors. Endocr Rev16:427-42 (1995) [PubMed]  Article
More Info.:Get all data from this article
 
Somatostatin receptor type 4
Name:Somatostatin receptor type 4
Synonyms:SOMATOSTATIN SST4 | SS-4-R | SS4-R | SS4R | SST4R | Somatostatin receptor type 4 (SSTR4)
Type:Enzyme
Mol. Mass.:42015.38
Organism:Homo sapiens (Human)
Description:P31391
Residue:388
Sequence:
MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV
GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR
AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP
IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA
VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS
YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM
CPPLPCQQEALQPEPGRKRIPLTRTTTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81766
NameBDBM81766
Synonyms:CAS_3086456 | MK 678 | NSC_3086456
TypeSmall organic molecule
Emp. Form.C44H56N8O7
Mol. Mass.808.9648
SMILESCC(C)C1NC(=O)C(CCCCN)NC(=O)C(Cc2c[nH]c3ccccc23)NC(=O)C(Cc2ccc(O)cc2)NC(=O)C(C)N(C)C(=O)C(Cc2ccccc2)NC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a