Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 2
LigandBDBM82463
Substrate/Competitorn/a
Ki 0.79±n/a nM
CommentsPDSP_1033
Citation Bruns, CRaulf, FHoyer, DSchloos, JLübbert, HWeckbecker, G Binding properties of somatostatin receptor subtypes. Metab Clin Exp45:17-20 (1996) [PubMed]
More Info.:Get all data from this article
 
Somatostatin receptor type 2
Name:Somatostatin receptor type 2
Synonyms:SOMATOSTATIN SST2 | SRIF-1 | SS-2-R | SS2-R | SS2R | SSTR2 | Somatostatin receptor type 2 (SSTR2)
Type:Enzyme
Mol. Mass.:41344.94
Organism:Homo sapiens (Human)
Description:P30874
Residue:369
Sequence:
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82463
NameBDBM82463
Synonyms:Cyclo[L-Trp-D-Trp-L-Lys-L-Thr-L-Phe-(7-amino*heptanoyl-L-Phe-)] | L-362,855 | L-362855
TypeSmall organic molecule
Emp. Form.C57H70N10O8
Mol. Mass.1023.2279
SMILESC[C@@H](O)[C@@H]1NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)CCCCCCNC(=O)[C@H](Cc2ccccc2)NC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a