Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 2
LigandBDBM50019568
Substrate/Competitorn/a
Ki 0.19±n/a nM
CommentsPDSP_1735
Citation Bruns, CRaulf, FHoyer, DSchloos, JLübbert, HWeckbecker, G Binding properties of somatostatin receptor subtypes. Metab Clin Exp45:17-20 (1996) [PubMed]
More Info.:Get all data from this article
 
Somatostatin receptor type 2
Name:Somatostatin receptor type 2
Synonyms:SOMATOSTATIN SST2 | SRIF-1 | SS-2-R | SS2-R | SS2R | SSTR2 | Somatostatin receptor type 2 (SSTR2)
Type:Enzyme
Mol. Mass.:41344.94
Organism:Homo sapiens (Human)
Description:P30874
Residue:369
Sequence:
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50019568
NameBDBM50019568
Synonyms:Ala-Gly-c(Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys)-OH | Ala-Gly-c-[Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys](SRIF-14) | CHEMBL411836 | H-Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys-OH (Disulfide bridge: 3-14) | H-Ala-Gly-c[Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys]-OH | SOMATOSTATIN | SRIF-14 | SRIF14 | Somatostatin receptor ligand | Somatostatin-14 | somatostatin(H-Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys-OH)
TypeSmall organic molecule
Emp. Form.C76H104N18O19S2
Mol. Mass.1637.878
SMILESC[C@@H](O)[C@H]1NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](CCCCN)NC(=O)[C@@H](CSSC[C@H](NC(=O)[C@H](CO)NC1=O)C(O)=O)NC(=O)CNC(=O)[C@H](C)N)[C@@H](C)O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a