Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR3
LigandBDBM50019568
Substrate/Competitorn/a
Ki 0.1±n/a nM
CommentsPDSP_1735
Citation Bass, RTBuckwalter, BLPatel, BPPausch, MHPrice, LAStrnad, JHadcock, JR Identification and characterization of novel somatostatin antagonists. Mol Pharmacol50:709-15 (1996) [PubMed]
More Info.:Get all data from this article
 
SSTR3
Name:Somatostatin receptor
Synonyms:SOMATOSTATIN SST3 | Somatostatin receptor type 3
Type:Enzyme Catalytic Domain
Mol. Mass.:47161.54
Organism:RAT
Description:SOMATOSTATIN SST3 SSTR3 RAT::P30936
Residue:428
Sequence:
MAAVTYPSSVPTTLDPGNASSAWPLDTSLGNASAGTSLAGLAVSGILISLVYLVVCVVGL
LGNSLVIYVVLRHTSSPSVTSVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLV
MAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARMVSAAVWVASAVVVLPVV
VFSGVPRGMSTCHMQWPEPAAAWRTAFIIYTAALGFFGPLLVICLCYLLIVVKVRSTTRR
VRAPSCQWVQAPACQRRRRSERRVTRMVVAVVALFVLCWMPFYLLNIVNVVCPLPEEPAF
FGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRILLRPSRRVRSQEPGSGPPEKTEEE
EDEEEEERREEEERRMQRGQEMNGRLSQIAQPGPSGQQQRPCTGTAKEQQLLPQEATAGD
KASTLSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50019568
NameBDBM50019568
Synonyms:Ala-Gly-c(Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys)-OH | Ala-Gly-c-[Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys](SRIF-14) | CHEMBL411836 | H-Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys-OH (Disulfide bridge: 3-14) | H-Ala-Gly-c[Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys]-OH | SOMATOSTATIN | SRIF-14 | SRIF14 | Somatostatin receptor ligand | Somatostatin-14 | somatostatin(H-Ala-Gly-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys-OH)
TypeSmall organic molecule
Emp. Form.C76H104N18O19S2
Mol. Mass.1637.878
SMILESC[C@@H](O)[C@H]1NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](CCCCN)NC(=O)[C@@H](CSSC[C@H](NC(=O)[C@H](CO)NC1=O)C(O)=O)NC(=O)CNC(=O)[C@H](C)N)[C@@H](C)O
Structure
n/a