Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM82557
Substrate/Competitorn/a
Ki 5±n/a nM
CommentsPDSP_945
Citation Hill, RJOleynek, JJHoth, CFKiron, MAWeng, WWester, RTTracey, WRKnight, DRBuchholz, RAKennedy, SP Cloning, expression and pharmacological characterization of rabbit adenosine A1 and A3 receptors. J Pharmacol Exp Ther280:122-8 (1997) [PubMed]
More Info.:Get all data from this article
 
Adenosine receptor A3
Name:Adenosine receptor A3
Synonyms:ADENOSINE A3
Type:Protein
Mol. Mass.:36319.35
Organism:Oryctolagus cuniculus (rabbit)
Description:O02667
Residue:319
Sequence:
MPDNSTTLFLAIRASYIVFEIVIGVCAVVGNVLVIWVIKLNPSLKTTTFYFIFSLALADI
AVGFLVMPLAIVISLGITIGFYSCLVMSCLLLVFTHASIMSLLAIAVDRYLRVKLTVRYR
RVTTQRRIWLALGLCWVVSLLVGFTPMFGWNMKPTLESARNYSDFQCKFDSVIPMEYMVF
FSFFTWILIPLLLMCALYVYIFYIIRNKLVQSFSSFKETGAFYRREFKTAKSLFLVLALF
AGCWLPLSIINCVTYFKCKVPDVVLLVGILLSHANSMMNPIVYACKIQKFKETYLLIFKA
RVTCQPSDSLDPSSEQNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82557
NameBDBM82557
Synonyms:I-ABA | IABA | N(6)-(4-Amino-3-iodobenzyl)adenosine
TypeSmall organic molecule
Emp. Form.C17H19IN6O4
Mol. Mass.498.275
SMILESNc1ccc(CNc2ncnc3n(cnc23)[C@@H]2O[C@H](CO)[C@@H](O)[C@H]2O)cc1I
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a