Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 4
LigandBDBM50300129
Substrate/Competitorn/a
Ki 39.2±n/a nM
CommentsPDSP_3584
Citation Garcia-Guzman, MSoto, FGomez-Hernandez, JMLund, PEStühmer, W Characterization of recombinant human P2X4 receptor reveals pharmacological differences to the rat homologue. Mol Pharmacol51:109-18 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
P2X purinoceptor 4
Name:P2X purinoceptor 4
Synonyms:ATP receptor | P2X4 | Purinergic receptor | Purinergic, P2X4
Type:Enzyme Catalytic Domain
Mol. Mass.:43374.70
Organism:Homo sapiens (Human)
Description:Purinergic, P2X4 0 HUMAN::Q99571
Residue:388
Sequence:
MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSV
VSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIP
DATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLK
AAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAG
HSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYY
RDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYC
MKKRLYYREKKYKYVEDYEQGLASELDQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50300129
NameBDBM50300129
Synonyms:CHEMBL572528 | CIBACRON BLUE | Cibacron Blue 3Ga
TypeSmall organic molecule
Emp. Form.C29H20ClN7O11S3
Mol. Mass.774.157
SMILESNc1c(cc(Nc2ccc(Nc3nc(Cl)nc(Nc4ccccc4S(O)(=O)=O)n3)c(c2)S(O)(=O)=O)c2C(=O)c3ccccc3C(=O)c12)S(O)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a