Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuromedin-K receptor
LigandBDBM50001450
Substrate/Competitorn/a
Ki 1292±n/a nM
CommentsPDSP_1775
Citation Sarau, HMGriswold, DEPotts, WFoley, JJSchmidt, DBWebb, EFMartin, LDBrawner, MEElshourbagy, NAMedhurst, ADGiardina, GAHay, DW Nonpeptide tachykinin receptor antagonists: I. Pharmacological and pharmacokinetic characterization of SB 223412, a novel, potent and selective neurokinin-3 receptor antagonist. J Pharmacol Exp Ther281:1303-11 (1997) [PubMed]
More Info.:Get all data from this article
 
Neuromedin-K receptor
Name:Neuromedin-K receptor
Synonyms:NK-3 receptor | NK-3R | NKR | Neurokinin 3 receptor | Neurokinin B receptor | Neurokinin-3 (NK-3) | Neuromedin-3 receptor (NK-3R) | Neuromedin-3 receptor (NK3) | Neuromedin-K receptor (NK3) | Tachykinin receptor 3 | Tachykinin receptor 3 (NK3)
Type:Enzyme
Mol. Mass.:52221.96
Organism:Homo sapiens (Human)
Description:P29371
Residue:465
Sequence:
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL
PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT
NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA
VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG
PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM
MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN
KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT
TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001450
NameBDBM50001450
Synonyms:(SP)Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 | Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met NH2 | Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 | Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2(Substance P) | Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2.(Substance P) | Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-amine | ArgProLysProGlnGlnPhePheGlyLeuMet | CHEMBL235363 | H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-D-Phe-Gly-Leu-Met-NH2 | H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2(Substance P) | Substance P | Substance P (Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-MetNH2) | Substance P analogue | tachykinin substance P (SP)
TypeSmall organic molecule
Emp. Form.C63H98N18O13S
Mol. Mass.1347.63
SMILES[#6]-[#16]-[#6]-[#6]-[#6@H](-[#7]-[#6](=O)-[#6@H](-[#6]-[#6](-[#6])-[#6])-[#7]-[#6](=O)-[#6]-[#7]-[#6](=O)-[#6@H](-[#6]-c1ccccc1)-[#7]-[#6](=O)-[#6@H](-[#6]-c1ccccc1)-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6](-[#7])=O)-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6](-[#7])=O)-[#7]-[#6](=O)-[#6@@H]-1-[#6]-[#6]-[#6]-[#7]-1-[#6](=O)-[#6@H](-[#6]-[#6]-[#6]-[#6]-[#7])-[#7]-[#6](=O)-[#6@@H]-1-[#6]-[#6]-[#6]-[#7]-1-[#6](=O)-[#6@@H](-[#7])-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](-[#7])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a