Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin receptor (2b and 2c)
LigandBDBM50001915
Substrate/Competitorn/a
Ki 28.8±n/a nM
CommentsPDSP_1168
Citation Wainscott, DBSasso, DAKursar, JDBaez, MLucaites, VLNelson, DL [3H]Rauwolscine: an antagonist radioligand for the cloned human 5-hydroxytryptamine2b (5-HT2B) receptor. Naunyn Schmiedebergs Arch Pharmacol357:17-24 (1998) [PubMed]
More Info.:Get all data from this article
 
Serotonin receptor (2b and 2c)
Name:Serotonin receptor (2b and 2c)
Synonyms:5-HT-2B | 5-HT2B | 5-hydroxytryptamine (serotonin) receptor 2B [Homo sapiens] | 5-hydroxytryptamine receptor 2B | 5-hydroxytryptamine receptor 2B (5-HT2B) | 5-hydroxytryptamine receptor 2C (5HT2C) | Serotonin (5-HT3) receptor | Serotonin 2b (5-HT2b) receptor | Serotonin Receptor 2B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:54312.47
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells.
Residue:481
Sequence:
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET
LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001915
NameBDBM50001915
Synonyms:1-(3-chlorophenyl)piperazine | CHEMBL478 | m-Chlorophenylpiperazine | mCPP
TypeSmall organic molecule
Emp. Form.C10H13ClN2
Mol. Mass.196.677
SMILESClc1cccc(c1)N1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a