Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2A adrenergic receptor
LigandBDBM50001922
Substrate/Competitorn/a
Ki 20.89±n/a nM
CommentsPDSP_1290
Citation Jasper, JRLesnick, JDChang, LKYamanishi, SSChang, TKHsu, SADaunt, DABonhaus, DWEglen, RM Ligand efficacy and potency at recombinant alpha2 adrenergic receptors: agonist-mediated [35S]GTPgammaS binding. Biochem Pharmacol55:1035-43 (1998) [PubMed]
More Info.:Get all data from this article
 
Alpha-2A adrenergic receptor
Name:Adenosine receptor A1/Alpha-2A adrenergic receptor
Synonyms:Adrenergic alpha2A | Adrenergic receptor alpha | Alpha-2 adrenergic receptor subtype C10 | Alpha-2A adrenoceptor | Alpha-2A adrenoreceptor | Alpha-2AAR | alpha-2A adrenergic receptor [Homo sapiens]
Type:Enzyme
Mol. Mass.:48979.91
Organism:Homo sapiens (Human)
Description:P08913
Residue:450
Sequence:
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGG
PQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVA
APPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSD
HAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001922
NameBDBM50001922
Synonyms:2-Naphthalen-1-ylmethyl-4,5-dihydro-1H-imidazole; hydrochloride | Albalon | CHEMBL1706 | NAPHAZOLINE | NAPHAZOLINE HYDROCHLORIDE | Nafazair | Naphazoline | Naphazoline Nitrate | Naphcon forte | Opcon | Vasocon | cid_11079
TypeSmall organic molecule
Emp. Form.C14H14N2
Mol. Mass.210.2744
SMILESC(C1=NCCN1)c1cccc2ccccc12 |t:1|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a