Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin
LigandBDBM85064
Substrate/Competitorn/a
Ki 0.61±n/a nM
CommentsPDSP_886
Citation Beresford, IJBrowning, CStarkey, SJBrown, JFoord, SMCoughlan, JNorth, PCDubocovich, MLHagan, RM GR196429: a nonindolic agonist at high-affinity melatonin receptors. J Pharmacol Exp Ther285:1239-45 (1998) [PubMed]
More Info.:Get all data from this article
 
Melatonin
Name:Melatonin
Synonyms:Melatonin receptor type 1A
Type:Enzyme Catalytic Domain
Mol. Mass.:17908.30
Organism:GUINEA PIG
Description:Melatonin 0 GUINEA PIG::O02781
Residue:154
Sequence:
YCYICHSLKYDRWYSNRNSLCCVFLICVLTLVAIVPNLCMGTLQYDPRIYSCTFAQSVSS
AYTIAVVVFHFLVPMVIVIFRYLRIWVLVLQIRWRAKPENNPRLKPQDFRNFVTMFVVFV
LFAICWAPLNFIGLAVASDPASMAPRIPEWLFVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85064
NameBDBM85064
Synonyms:CAS_5311134 | GR 196429 | NSC_5311134
TypeSmall organic molecule
Emp. Form.C14H18N2O2
Mol. Mass.246.3049
SMILESCC(=O)NCCN1CCc2ccc3OCCc3c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a