Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRA1B
LigandBDBM29568
Substrate/Competitorn/a
Ki 0.16±n/a nM
CommentsPDSP_1528
Citation Wikberg-Matsson, AWikberg, JEUhlén, S Characterization of alpha1-adrenoceptor subtypes in the pig. Eur J Pharmacol347:301-9 (1998) [PubMed]
More Info.:Get all data from this article
 
ADRA1B
Name:ADRA1B
Synonyms:adrenergic Alpha1B
Type:Enzyme Catalytic Domain
Mol. Mass.:34826.67
Organism:PIG
Description:Q70HQ0
Residue:316
Sequence:
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29568
NameBDBM29568
Synonyms:CHEMBL2 | PRAZOSIN | PRAZOSIN HYDROCHLORIDE | [3H]-Furazosin | [3H]-Minipress | [3H]-Pratsiol | [3H]-Prazosin
Typeradiolabeled ligand
Emp. Form.C19H21N5O4
Mol. Mass.383.4011
SMILESCOc1cc2nc(nc(N)c2cc1OC)N1CCN(CC1)C(=O)c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a