Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNPY2R
LigandBDBM85375
Substrate/Competitorn/a
Ki 0.117±n/a nM
CommentsPDSP_7552
Citation Sharma, PHolmberg, SKEriksson, HBeck-Sickinger, AGGrundemar, LLarhammar, D Cloning and functional expression of the guinea pig neuropeptide Y Y2 receptor. Regul Pept0:23-8 (1998) [PubMed]
More Info.:Get all data from this article
 
NPY2R
Name:NPY2R
Synonyms:NPY-Y2 | Neuropeptide Y receptor type 2
Type:Enzyme Catalytic Domain
Mol. Mass.:42344.53
Organism:GUINEA PIG
Description:NPY-Y2 NPY2R GUINEA PIG::Q9Z2D5
Residue:381
Sequence:
MGPIGTEADENQTVEEIKVEPYGPGHTTPRGELAPDPEPELIDSTKLTEVRVVLILAYCS
IILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMG
PVLCHLVPYAQGLAVQVSTVTLTVIALDRHRCIVYHLDSKISKQNSFLIIGLAWGISALL
ASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISVSY
VRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVFVVVVFAVSWLPLHAFQLAVDIDSQVLD
LKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCQQRLDAIQSEVCVTGKA
KTNVEVEKNHGAADSAEATNV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85375
NameBDBM85375
Synonyms:NPY8-20, Ahx
TypeSmall organic molecule
Emp. Form.C135H208N40O36
Mol. Mass.2967.3424
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CCCCCNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a