Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptor
LigandBDBM11638
Substrate/Competitorn/a
Ki 0.71±n/a nM
CommentsPDSP_1779
Citation Lawler, CPPrioleau, CLewis, MMMak, CJiang, DSchetz, JAGonzalez, AMSibley, DRMailman, RB Interactions of the novel antipsychotic aripiprazole (OPC-14597) with dopamine and serotonin receptor subtypes. Neuropsychopharmacology20:612-27 (1999) [PubMed]  Article
More Info.:Get all data from this article
 
Dopamine receptor
Name:Dopamine receptor D2 and D3
Synonyms:D(3) dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor
Type:Protein
Mol. Mass.:49540.58
Organism:Rattus norvegicus (Rat)
Description:P19020
Residue:446
Sequence:
MAPLSQISTHLNSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI
CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYIVLRQRQRKRILTRQNSQCISIRPGFPQ
QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKQYPQKCQDPLLSHLQPPSPGQTHGGLK
RYYSICQDTALRHPSLEGGAGMSPVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLRLGP
LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV
NSALNPVIYTTFNVEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11638
NameBDBM11638
Synonyms:CHEMBL26 | Compound 7 | N-[(1-ethylpyrrolidin-2-yl)methyl]-2-methoxy-5-sulfamoylbenzamide | SULPIRIDE,(+) | SULPIRIDE,(-) | Sulpiride | Sulpiride, SLP | Sulpiride-R | US10172837, Sulpiride
TypeSmall organic molecule
Emp. Form.C15H23N3O4S
Mol. Mass.341.426
SMILESCCN1CCCC1CNC(=O)c1cc(ccc1OC)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a