Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptor
LigandBDBM82065
Substrate/Competitorn/a
Ki 280±n/a nM
CommentsPDSP_1418
Citation Lawler, CPPrioleau, CLewis, MMMak, CJiang, DSchetz, JAGonzalez, AMSibley, DRMailman, RB Interactions of the novel antipsychotic aripiprazole (OPC-14597) with dopamine and serotonin receptor subtypes. Neuropsychopharmacology20:612-27 (1999) [PubMed]  Article
More Info.:Get all data from this article
 
Dopamine receptor
Name:Dopamine receptor
Synonyms:D(4) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.4
Type:Enzyme Catalytic Domain
Mol. Mass.:41307.65
Organism:RAT
Description:DOPAMINE D4.4 0 RAT::P30729
Residue:387
Sequence:
MGNSSATGDGGLLAGRGPESLGTGTGLGGAGAAALVGGVLLIGMVLAGNSLVCVSVASER
ILQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI
FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVAAPVVCGLNDVPGRDPTVC
CLEDRDYVVYSSICSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV
SDPTQGPLFSDCPPPSPSLRTSPTVSSRPESDLSQSPCSPGCLLPDAALAQPPAPSSRRK
RGAKITGRERKAMRVLPVVVGAFLMCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN
SALNPIIYTIFNAEFRSVFRKTLRLRC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82065
NameBDBM82065
Synonyms:CAS_163839 | NSC_163839 | OPC-4392
TypeSmall organic molecule
Emp. Form.C24H29N3O2
Mol. Mass.391.506
SMILESCc1cccc(N2CCN(CCCOc3ccc4ccc(=O)[nH]c4c3)CC2)c1C
Structure
n/a