Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 4
LigandBDBM82467
Substrate/Competitorn/a
Ki 2.39±n/a nM
CommentsPDSP_489
Citation Siehler, SSeuwen, KHoyer, D Characterisation of human recombinant somatostatin receptors. 1. Radioligand binding studies. Naunyn Schmiedebergs Arch Pharmacol360:488-99 (1999) [PubMed]
More Info.:Get all data from this article
 
Somatostatin receptor type 4
Name:Somatostatin receptor type 4
Synonyms:SOMATOSTATIN SST4 | SS-4-R | SS4-R | SS4R | SST4R | Somatostatin receptor type 4 (SSTR4)
Type:Enzyme
Mol. Mass.:42015.38
Organism:Homo sapiens (Human)
Description:P31391
Residue:388
Sequence:
MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV
GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR
AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP
IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA
VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS
YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM
CPPLPCQQEALQPEPGRKRIPLTRTTTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82467
NameBDBM82467
Synonyms:2-Deamino-L-Abu(1)-L-Lys-L-Asp(NH2)-L-Phe-L-Phe-L-Trp-L-Lys-L-Thr-L-Tyr-L-Thr-L-Ser-L-Abu(1)-OH | CGP 23996 | CGP-23996
TypeSmall organic molecule
Emp. Form.C73H99N15O18
Mol. Mass.1474.6569
SMILESC[C@H](O)[C@@H]1NC(=O)C(CCCCN)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)C(Cc2ccccc2)NC(=O)C(Cc2ccccc2)NC(=O)C(CC(N)=O)NC(=O)C(CCCCN)NC(=O)CCCCC[C@@H](NC(=O)[C@@H](CO)NC(=O)[C@H](NC(=O)[C@@H](Cc2ccc(O)cc2)NC1=O)[C@H](C)O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a