Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2C adrenergic receptor
LigandBDBM50025206
Substrate/Competitorn/a
Ki 6.03±n/a nM
CommentsPDSP_1863
Citation Millan, MJMaiofiss, LCussac, DAudinot, VBoutin, JANewman-Tancredi, A Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther303:791-804 (2002) [PubMed]  Article
More Info.:Get all data from this article
 
Alpha-2C adrenergic receptor
Name:Adrenergic receptor alpha
Synonyms:Adrenergic alpha2C | Adrenergic receptor alpha | Adrenergic, alpha-2C-, receptor | Alpha-2 adrenergic receptor subtype C4 | Alpha-2C adrenoceptor | Alpha-2C adrenoreceptor | adrenergic, alpha-2C-, receptor [Homo sapiens]
Type:Enzyme
Mol. Mass.:49552.32
Organism:Homo sapiens (Human)
Description:P18825
Residue:462
Sequence:
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR
RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50025206
NameBDBM50025206
Synonyms:(6,7-Dihydroxy-1,2,3,4-tetrahydro-naphthalen-2-yl)-dimethyl-ammonium | TL99
TypeSmall organic molecule
Emp. Form.C12H18NO2
Mol. Mass.208.2763
SMILESC[NH+](C)C1CCc2cc(O)c(O)cc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a