Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H1 receptor
LigandBDBM50025206
Substrate/Competitorn/a
Ki 776.25±n/a nM
CommentsPDSP_1863
Citation Millan, MJMaiofiss, LCussac, DAudinot, VBoutin, JANewman-Tancredi, A Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther303:791-804 (2002) [PubMed]  Article
More Info.:Get all data from this article
 
Histamine H1 receptor
Name:Histamine H1 receptor
Synonyms:HISTAMINE H1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:55641.53
Organism:Cavia porcellus (domestic guinea pig)
Description:Guinea pig cerebellum was used in binding assay.
Residue:488
Sequence:
MSFLPGMTPVTLSNFSWALEDRMLEGNSTTTPTRQLMPLVVVLSSVSLVTVALNLLVLYA
VRSERKLHTVGNLYIVSLSVADLIVGAVVMPMSILYLHRSAWILGRPLCLFWLSMDYVAS
TASIFSVFILCIDRYRSVQQPLRYLRYRTKTRASATILGAWLLSFLWVIPILGWHHFMAP
TSEPREKKCETDFYDVTWFKVMTAIINFYLPTLLMLWFYIRIYKAVRRHCQHRQLINSSL
PSFSEMKLKLENAKVDTRRMGKESPWEDPKRCSKDASGVHTPMPSSQHLVDMPCAAVLSE
DEGGEVGTRQMPMLAVGDGRCCEALNHMHSQLELSGQSRATHSISARPEEWTVVDGQSFP
ITDSDTSTEAAPMGGQPRSGSNSGLDYIKFTWRRLRSHSRQYTSGLHLNRERKAAKQLGC
IMAAFILCWIPYFVFFMVIAFCKSCSNEPVHMFTIWLGYLNSTLNPLIYPLCNENFRKTF
KRILRIPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50025206
NameBDBM50025206
Synonyms:(6,7-Dihydroxy-1,2,3,4-tetrahydro-naphthalen-2-yl)-dimethyl-ammonium | TL99
TypeSmall organic molecule
Emp. Form.C12H18NO2
Mol. Mass.208.2763
SMILESC[NH+](C)C1CCc2cc(O)c(O)cc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a