Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNPFF
LigandBDBM86147
Substrate/Competitorn/a
Ki 2.2±n/a nM
CommentsPDSP_3003
Citation Engström, MBrandt, AWurster, SSavola, JMPanula, P Prolactin releasing peptide has high affinity and efficacy at neuropeptide FF2 receptors. J Pharmacol Exp Ther305:825-32 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
NPFF
Name:NPFF
Synonyms:FMRFamide-related peptides
Type:Enzyme Catalytic Domain
Mol. Mass.:13156.33
Organism:RAT
Description:NPFF 0 RAT::Q9WVA9
Residue:114
Sequence:
MDSKWAAVLLLLLLLRNWGHAEEAGSWGEDQVFAEEDKGPHPSQYAHTPDRIQTPGSLMR
VLLQAMERPRRNPAFLFQPQRFGRNAWGPWSKEQLSPQAREFWSLAAPQRFGKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86147
NameBDBM86147
Synonyms:CAS_68615 | FMRFamide | NSC_68615
TypeSmall organic molecule
Emp. Form.C29H42N8O4S
Mol. Mass.598.76
SMILES[#6]-[#16]-[#6]-[#6]-[#6](-[#7]-[#6](=O)-[#6](-[#7])-[#6]-c1ccccc1)-[#6](=O)-[#7]-[#6](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6](-[#6]-c1ccccc1)-[#6](-[#7])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a