Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine Kinase (AK)
LigandBDBM50133817
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_7569
Citation Valenzano, KJGrant, ERWu, GHachicha, MSchmid, LTafesse, LSun, QRotshteyn, YFrancis, JLimberis, JMalik, SWhittemore, ERHodges, D N-(4-tertiarybutylphenyl)-4-(3-chloropyridin-2-yl)tetrahydropyrazine -1(2H)-carbox-amide (BCTC), a novel, orally effective vanilloid receptor 1 antagonist with analgesic properties: I. in vitro characterization and pharmacokinetic properties. J Pharmacol Exp Ther306:377-86 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Adenosine Kinase (AK)
Name:Adenosine kinase
Synonyms:ADENOSINE | Adenosine 5-phosphotransferase
Type:Enzyme
Mol. Mass.:40130.14
Organism:Rattus norvegicus (rat)
Description:Rat brain cytosol as enzyme source.
Residue:361
Sequence:
MAAADEPKPKKLKVEAPEALSENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDK
HKELFDELVKKFKVEYHAGGSTQNSMKVAQWMIQEPHRAATFFGCIGIDKFGEILKSKAA
DAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLENNWMLVEKARV
YYIAGFFLTVSPESVLKVARYAAENNRTFTLNLSAPFISQFFKEALMEVMPYVDILFGNE
TEAATFAREQGFETKDIKEIARKTQALPKVNSKRQRTVIFTQGRDDTIVATGNDVTAFPV
LDQNQEEIVDTNGAGDAFVGGFLSQLVSNKPLTECIRAGHYAASVIIRRTGCTFPEKPDF
H
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50133817
NameBDBM50133817
Synonyms:4-(3-Chloro-pyridin-2-yl)-piperazine-1-carboxylic acid (4-tert-butyl-phenyl)-amide | BCTC | CHEMBL441472 | N-(4-tert-butylphenyl)-4-(3-chloropyridin-2-yl)piperazine-1-carboxamide
TypeSmall organic molecule
Emp. Form.C20H25ClN4O
Mol. Mass.372.892
SMILESCC(C)(C)c1ccc(NC(=O)N2CCN(CC2)c2ncccc2Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a