Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2
LigandBDBM86760
Substrate/Competitorn/a
Ki 46.20±n/a nM
CommentsPDSP_2625
Citation Ohshita, KIshiyama, HOyanagi, KNakata, HKobayashi, J Synthesis of hybrid molecules of caffeine and eudistomin D and its effects on adenosine receptors. Bioorg Med Chem15:3235-40 (2007) [PubMed]  Article
More Info.:Get all data from this article
 
Adenosine receptor A2
Name:Adenosine receptor A2
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2 | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (Human)
Description:P29274
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86760
NameBDBM86760
Synonyms:CAS_104924 | CGS 21680 | NSC_104924
TypeSmall organic molecule
Emp. Form.C23H29N7O6
Mol. Mass.499.5197
SMILESCCNC(=O)C1OC(C(O)C1O)n1cnc2c(N)nc(NCCc3ccc(CCC(O)=O)cc3)nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a