Target
Prolyl hydroxylase EGLN3
Ligand
BDBM93419
Substrate
n/a
Meas. Tech.
PHD Enzymatic Assay
IC50
20±n/a nM
Citation
 Murray, JKBalan, CAllgeier, AMKasparian, AViswanadhan, VWilde, CAllen, JRYoder, SCBiddlecome, GHungate, RWMiranda, LP Dipeptidyl-quinolone derivatives inhibit hypoxia inducible factor-1a prolyl hydroxylases-1, -2, and -3 with altered selectivity. J Comb Chem 12:676-86 (2010) [PubMed]  Article
Target
Name:
Prolyl hydroxylase EGLN3
Synonyms:
Egl nine homolog 3 (EGLIN3) | Egl nine homolog 3 (EGLN3)
Type:
Protein
Mol. Mass.:
27265.54
Organism:
Homo sapiens (Human)
Description:
Q9H6Z9
Residue:
239
Sequence:
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
  
Inhibitor
Name:
BDBM93419
Synonyms:
PHD Inhibitor, 12{2,4,1}
Type:
Small molecule
Emp. Form.:
C39H37N5O8
Mol. Mass.:
703.7398
SMILES:
Cn1c2ccc(CNC(=O)[C@@H](Cc3ccccc3)NC(=O)[C@@H](Cc3ccccc3)NC(=O)c3ccccc3)cc2c(O)c(C(=O)NCC(O)=O)c1=O |r|
Structure:
Search PDB for entries with ligand similarity: