BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein subunit alpha-16
LigandBDBM50001922
Substrate/Competitorn/a
IC50>29925±n/a nM
Citation PubChem, PC Counterscreen for agonists of the human trace amine associated receptor 1 (TAAR1): Fluorescence-based cell-based high throughput dose response assay to identify nonselective Ga16 antagonists PubChem Bioassay(2013)[AID]
More Info.:Get all data from this article
 
G-protein subunit alpha-16
Name:G-protein subunit alpha-16
Synonyms:G-protein subunit alpha-16 (G alpha-16) | guanine nucleotide-binding protein subunit alpha-15
Type:Protein
Mol. Mass.:43577.62
Organism:Homo sapiens (Human)
Description:P30679
Residue:374
Sequence:
MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIK
QMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQD
PYKVTTFEKRYAAAMQWLWRDAGIRAYYERRREFHLLDSAVYYLSHLERITEEGYVPTAQ
DVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQ
CLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQG
PKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVR
DSVLARYLDEINLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001922
NameBDBM50001922
Synonyms:2-Naphthalen-1-ylmethyl-4,5-dihydro-1H-imidazole; hydrochloride | Albalon | CHEMBL1706 | NAPHAZOLINE | NAPHAZOLINE HYDROCHLORIDE | Nafazair | Naphazoline | Naphazoline Nitrate | Naphcon forte | Opcon | Vasocon | cid_11079
TypeSmall organic molecule
Emp. Form.C14H14N2
Mol. Mass.210.2744
SMILESC(C1=NCCN1)c1cccc2ccccc12 |t:1|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a