Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAnandamide amidohydrolase
LigandBDBM280565
Substrate/Competitorn/a
Meas. Tech.In Vitro Competitive Activity-Based Protein Profiling
IC50>1000±n/a nM
Citation Cisar, JSGrice, CAJones, TKWeber, ODBuzard, DJShaghafi, MB Spirocycle compounds and methods of making and using same US Patent US10030020 Publication Date 7/24/2018
More Info.:Get all data from this article,  Assay Method
 
Anandamide amidohydrolase
Name:Anandamide amidohydrolase
Synonyms:Anandamide amidohydrolase 1 | Fatty Acid Amide Hydrolase | Fatty-acid amide hydrolase (FAAH) | Fatty-acid amide hydrolase 1 | Oleamide hydrolase 1
Type:Hydrolase; single-pass membrane protein; homodimer
Mol. Mass.:63227.28
Organism:Mus musculus (mouse)
Description:Mouse brain membranes were used in the assay.
Residue:579
Sequence:
MVLSEVWTALSGLSGVCLACSLLSAAVVLRWTRSQTARGAVTRARQKQRAGLETMDKAVQ
RFRLQNPDLDSEALLALPLLQLVQKLQSGELSPEAVLFTYLGKAWEVNKGTNCVTSYLTD
CETQLSQAPRQGLLYGVPVSLKECFSYKGHASTLGLSLNEGVTSESDCVVVQVLKLQGAV
PFVHTNVPQSMLSYDCSNPLFGQTMNPWKPSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSAFCGICGLKPTGNRLSKSGLKSCVYGQTAVQLSVGPMARDVDSLALCMKALLCE
DLFRLDSTIPPLPFREEIYRSSRPLRVGYYETDNYTMPTPAMRRAVMETKQSLEAAGHTL
VPFLPNNIPYALEVLSAGGLFSDGGCSFLQNFKGDFVDPCLGDLVLVLKLPRWFKKLLSF
LLKPLFPRLAAFLNSMCPRSAEKLWELQHEIEMYRQSVIAQWKAMNLDVVLTPMLGPALD
LNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMEHYKGYFGDMWDNILKKGMK
KGIGLPVAVQCVALPWQEELCLRFMREVERLMTPEKRPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM280565
NameBDBM280565
Synonyms:US10030020, Example 110 | US10781211, Example 110
TypeSmall organic molecule
Emp. Form.C24H29ClF7N3O2
Mol. Mass.559.948
SMILESFC1CCN(CC1)c1cccc(CN2CCCC22CCN(CC2)C(=O)OC(C(F)(F)F)C(F)(F)F)c1Cl
Structure
n/a