Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoacylglycerol lipase ABHD2
LigandBDBM280565
Substrate/Competitorn/a
Meas. Tech.In Vitro Competitive Activity-Based Protein Profiling
IC50>1000±n/a nM
Citation Cisar, JSGrice, CAJones, TKWeber, ODBuzard, DJShaghafi, MB Spirocycle compounds and methods of making and using same US Patent US10030020 Publication Date 7/24/2018
More Info.:Get all data from this article,  Assay Method
 
Monoacylglycerol lipase ABHD2
Name:Monoacylglycerol lipase ABHD2
Synonyms:2-arachidonoylglycerol hydrolase | Abhd2 | Abhydrolase domain-containing protein 2 | Labh-2 | Lung alpha/beta hydrolase 2 | MmLABH2
Type:Enzyme Catalytic Domain
Mol. Mass.:48378.90
Organism:Mus musculus (Mouse)
Description:n/a
Residue:425
Sequence:
MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCP
LLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEH
CVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYG
CTWEFGAMVNYIKRTYPQTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSAL
RAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSL
MQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLS
EKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKSQCSDTEQM
EAELE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM280565
NameBDBM280565
Synonyms:US10030020, Example 110 | US10781211, Example 110
TypeSmall organic molecule
Emp. Form.C24H29ClF7N3O2
Mol. Mass.559.948
SMILESFC1CCN(CC1)c1cccc(CN2CCCC22CCN(CC2)C(=O)OC(C(F)(F)F)C(F)(F)F)c1Cl
Structure
n/a