Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-2
LigandBDBM41535
Substrate/Competitorn/a
Meas. Tech.PIM-2 Enzyme Assay
IC50 0.5±n/a nM
Citation Allen, SCeleste, LLDavis, TGDeLisle, RKGreschuk, JMGross, SDHicken, EJJackson, LJKallan, NCLyssikatos, JPMarmsater, FPMunson, MCPheneger, JRast, BRobinson, JESchlachter, STTopalov, GTWright, ADZhao, Q Triazolopyridine compounds as PIM kinase inhibitors US Patent US8575145 Publication Date 11/5/2013
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pim-2
Name:Serine/threonine-protein kinase PIM
Synonyms:Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase pim-2 (PIM2)
Type:Serine/threonine-protein kinase
Mol. Mass.:34185.93
Organism:Homo sapiens (Human)
Description:Q9P1W9
Residue:311
Sequence:
MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM41535
NameBDBM41535
Synonyms:US8575145, 106 | US8575145, 66
Typen/a
Emp. Form.C21H20FN5O
Mol. Mass.377.4148
SMILESFC1(COc2cccc3ccc(nc23)-c2nnc3ccccn23)CCNCC1
Structure
n/a