Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-1
LigandBDBM104183
Substrate/Competitorn/a
Meas. Tech.PIM-1 Enzyme Assay
pH7.4±0
Temperature295.15±0 K
IC50 26±0.0 nM
Citation Allen, SCeleste, LLDavis, TGDeLisle, RKGreschuk, JMGross, SDHicken, EJJackson, LJKallan, NCLyssikatos, JPMarmsater, FPMunson, MCPheneger, JRast, BRobinson, JESchlachter, STTopalov, GTWright, ADZhao, Q Triazolopyridine compounds as PIM kinase inhibitors US Patent US8575145 Publication Date 11/5/2013
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Serine/threonine-protein kinase pim-1
Name:Serine/threonine-protein kinase PIM
Synonyms:PIM-1 Kinase | PIM1 | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1)
Type:Protein
Mol. Mass.:35681.82
Organism:Homo sapiens (Human)
Description:P11309
Residue:313
Sequence:
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM104183
NameBDBM104183
Synonyms:US8575145, 60
TypeSmall organic molecule
Emp. Form.C20H17F2N5O
Mol. Mass.381.3787
SMILESFC1CNCCC1Oc1cccc2ccc(nc12)-c1nnc2cc(F)ccn12
Structure
n/a