Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-tyrosine phosphatase 1B
LigandBDBM50346601
Substrate/Competitorn/a
Meas. Tech.pNPP assay
IC50 1.90e+3± 1.1e+2 nM
Citation Wang, WLHuang, CGao, LXTang, CLWang, JQWu, MCSheng, LChen, HJNan, FJLi, JYLi, JFeng, B Synthesis and biological evaluation of novel bis-aromatic amides as novel PTP1B inhibitors. Bioorg Med Chem Lett24:1889-94 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-tyrosine phosphatase 1B
Name:Protein-tyrosine phosphatase 1B
Synonyms:PTP1B | Protein tyrosine phosphatase 1B (PTP1B) | Protein tyrosine phosphatase-1B (PTP1B) | Protein-tyrosine phosphatase 1B (PTP1B) | Tyrosine-protein phosphatase non-receptor type 1 | Tyrosine-protein phosphatase non-receptor type 1 (PTP1B)
Type:Protein phosphatase
Mol. Mass.:49963.76
Organism:Homo sapiens (human)
Description:Human recombinant GST-fusion PTP1B (1-435).
Residue:435
Sequence:
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG
IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50346601
NameBDBM50346601
Synonyms:NSC-114945 | OLEANOLIC_ACID | Oleanolic acid | Oleanolic acid (OA)(Compound 1)
TypeSmall organic molecule
Emp. Form.C30H48O3
Mol. Mass.456.7003
SMILESCC1(C)CC[C@@]2(CC[C@]3(C)C(=CC[C@@H]4[C@@]5(C)CC[C@H](O)C(C)(C)[C@@H]5CC[C@@]34C)[C@@H]2C1)C(O)=O |r,c:10|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a