Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-tyrosine phosphatase 1C
LigandBDBM124249
Substrate/Competitorn/a
Meas. Tech.pNPP assay
IC50 1.776e+4± 2.35e+3 nM
Citation Wang, WLHuang, CGao, LXTang, CLWang, JQWu, MCSheng, LChen, HJNan, FJLi, JYLi, JFeng, B Synthesis and biological evaluation of novel bis-aromatic amides as novel PTP1B inhibitors. Bioorg Med Chem Lett24:1889-94 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-tyrosine phosphatase 1C
Name:Protein-tyrosine phosphatase 1C
Synonyms:Protein tyrosine phosphatase SHP-1 (SHP-1) | Protein-tyrosine phosphatase SHP-1 | Src homology phosphatase 1 (SHP-1) | Tyrosine-protein phosphatase non-receptor type 6 | Tyrosine-protein phosphatase non-receptor type 6 (SHP1)
Type:Protein
Mol. Mass.:67570.41
Organism:Homo sapiens (Human)
Description:P29350
Residue:595
Sequence:
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
ETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
LETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSD
YINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNK
CVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNIT
YPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM124249
NameBDBM124249
Synonyms:4-fluoro-N-(6-(4-(4-fluorobenzamido)phenyl)pyridin-3-yl)benzamide (29)
TypeSmall organic molecule
Emp. Form.C25H17F2N3O2
Mol. Mass.429.4182
SMILESFc1ccc(cc1)C(=O)Nc1ccc(cc1)-c1ccc(NC(=O)c2ccc(F)cc2)cn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a