Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein phosphatase non-receptor type 11
LigandBDBM124233
Substrate/Competitorn/a
Meas. Tech.pNPP assay
IC50 5.207e+4± 6.08e+3 nM
Citation Wang, WLHuang, CGao, LXTang, CLWang, JQWu, MCSheng, LChen, HJNan, FJLi, JYLi, JFeng, B Synthesis and biological evaluation of novel bis-aromatic amides as novel PTP1B inhibitors. Bioorg Med Chem Lett24:1889-94 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein phosphatase non-receptor type 11
Name:Tyrosine-protein phosphatase non-receptor type 11
Synonyms:PTP-1D | PTP-2C | PTPN11 | Protein Tyrosine Phosphatase PPN11/Shp2 | Protein tyrosine phosphatase (PTP) Shp2 | Protein-Tyrosine Phosphatase SHP-2 | Protein-tyrosine phosphatase 2C | SH-PTP3 | SHP2 | Src homology phosphatase 2 (SHP-2) | Tyrosine-protein phosphatase non-receptor type 11 (PTPN11) | Tyrosine-protein phosphatase non-receptor type 11 (SHP-2) | Tyrosine-protein phosphatase non-receptor type 11 (SHP2)
Type:Protein phosphatase
Mol. Mass.:68443.59
Organism:Homo sapiens (human)
Description:Human recombinant GST-fusion SHP-2 (Calbiochem).
Residue:597
Sequence:
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM124233
NameBDBM124233
Synonyms:N‐{4‐[4‐(furan‐2‐amido)phenyl]phenyl}furan‐2‐ carboxamide (1)
TypeSmall organic molecule
Emp. Form.C22H16N2O4
Mol. Mass.372.3734
SMILESO=C(Nc1ccc(cc1)-c1ccc(NC(=O)c2ccco2)cc1)c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a