Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman cytomegalovirus protease (HCMV Pr)
LigandBDBM36460
Substrate/Competitorn/a
Meas. Tech.Nuclear Magnetic Resonance (NMR) Assay
pH8±n/a
IC50 7.4e+3± 2e+3 nM
Commentsextracted
Citation Gable, JELee, GMJaishankar, PHearn, BRWaddling, CARenslo, ARCraik, CS Broad-spectrum allosteric inhibition of herpesvirus proteases. Biochemistry53:4648-60 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human cytomegalovirus protease (HCMV Pr)
Name:Human herpes virus 5 capsid protein P40
Synonyms:Assemblin | Assembly protein | Capsid protein P40 | Protease precursor | pPR
Type:PROTEIN
Mol. Mass.:73854.16
Organism:Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
Description:ChEMBL_158958
Residue:708
Sequence:
MTMDEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQGQGQPSLSVALPLN
INHDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASEKSELVSRGPVSPLQPDKV
VEFLSGSYAGLSLSSRRCDDVEAATSLSGSETTPFKHVALCSVGRRRGTLAVYGRDPEWV
TQRFPDLTAADRDGLRAQWQRCGSTAVDASGDPFRSDSYGLLGNSVDALYIRERLPKLRY
DKQLVGVTERESYVKASVSPEAACDIKAASAERSGDSRSQAATPAAGARVPSSSPSPPVE
PPSPVQPPALPASPSVLPAESPPSLSPSEPAEAASMSHPLSAAVPAATAPPGATVAGASP
AVSSLAWPHDGVYLPKDAFFSLLGASRSAVPVMYPGAVAAPPSASPAPLPLPSYPASYGA
PVVGYDQLAARHFADYVDPHYPGWGRRYEPAPSLHPSYPVPPPPSPAYYRRRDSPGGMDE
PPSGWERYDGGHRGQSQKQHRHGGSGGHNKRRKETAAASSSSSDEDLSFPGEAEHGRARK
RLKSHVNSDGGSGGHAGSNQQQQQRYDELRDAIHELKRDLFAARQSSTLLSAALPSAASS
SPTTTTVCTPTGELTSGGGETPTALLSGGAKVAERAQAGVVNASCRLATASGSEAATAGP
STAGSSSCPASVVLAAAAAQAAAASQSPPKDMVDLNRRIFVAALNKLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36460
NameBDBM36460
Synonyms:3-Benzyl-4-(6-(cyclohexylmethyl)picolinamido)benzoic acid, 2 | CID42628632 | DD2
TypeSmall organic moelcule
Emp. Form.C27H28N2O3
Mol. Mass.428.5228
SMILESOC(=O)c1ccc(NC(=O)c2cccc(CC3CCCCC3)n2)c(Cc2ccccc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a