Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMethyl-CpG-binding protein 2
LigandBDBM158511
Substrate/Competitorn/a
Meas. Tech.Binding Assay
IC50 33900±n/a nM
Citation Nelson, WGYegnasubramanian, SLin, XSpeed, TJReichert, Z Agents for reversing epigenetic silencing of genes US Patent US9034574 Publication Date 5/19/2015
More Info.:Get all data from this article,  Assay Method
 
Methyl-CpG-binding protein 2
Name:Methyl-CpG-binding protein 2
Synonyms:Small conductance calcium-activated potassium channel protein 3
Type:n/a
Mol. Mass.:52482.84
Organism:Homo sapiens (Human)
Description:P51608
Residue:486
Sequence:
MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAG
KAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY
DVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPK
APGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGAT
TSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETV
LPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASS
PPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPR
GGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTP
VTERVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM158511
NameBDBM158511
Synonyms:US9034574, XXI
TypeSmall organic molecule
Emp. Form.C14H11ClN2S
Mol. Mass.274.769
SMILESClc1ccc(cc1)C1NN=C(S1)c1ccccc1 |c:10|
Structure
n/a