Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSmall conductance calcium-activated potassium channel protein 3
LigandBDBM47365
Substrate/Competitorn/a
Meas. Tech.Binding Assay
IC50>200000±n/a nM
Citation Nelson, WGYegnasubramanian, SLin, XSpeed, TJReichert, Z Agents for reversing epigenetic silencing of genes US Patent US9034574 Publication Date 5/19/2015
More Info.:Get all data from this article,  Assay Method
 
Small conductance calcium-activated potassium channel protein 3
Name:Methyl-CpG-binding protein 2
Synonyms:n/a
Type:n/a
Mol. Mass.:52482.84
Organism:Homo sapiens (Human)
Description:P51608
Residue:486
Sequence:
MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAG
KAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY
DVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPK
APGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGAT
TSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETV
LPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASS
PPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPR
GGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTP
VTERVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM47365
NameBDBM47365
Synonyms:US9034574, X
Typen/a
Emp. Form.C15H11N3O4
Mol. Mass.297.2655
SMILESCOc1ccccc1-c1nc(no1)-c1cccc(c1)[N+]([O-])=O
Structure
n/a