Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMethionine aminopeptidase 2
LigandBDBM188704
Substrate/Competitorn/a
Meas. Tech.Enzymatic Screening Assay
IC50 1.46±n/a nM
Citation Benazet, ADuclos, OGuillo, NLassalle, GMacary, KVin, V Pyrazoloquinolinone derivatives, preparation thereof and therapeutic use thereof US Patent US9169246 Publication Date 10/27/2015
More Info.:Get all data from this article,  Assay Method
 
Methionine aminopeptidase 2
Name:Methionine aminopeptidase 2
Synonyms:Initiation factor 2-associated 67 kDa glycoprotein | MAP 2 | MetAP 2 | Methionine aminopeptidase 2 (MetAP2) | Methionine aminopeptidases (HsMetAP2) | Peptidase M 2 | p67 | p67eIF2
Type:Enzyme
Mol. Mass.:52884.45
Organism:Homo sapiens (Human)
Description:P50579
Residue:478
Sequence:
MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSAAGEQEPDKES
GASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPI
CDLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVR
KYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTT
VLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDV
GEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGGEATRMEEGEV
YAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWL
DRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM188704
NameBDBM188704
Synonyms:US9169246, 246
TypeSmall organic molecule
Emp. Form.C21H18F3N5O2
Mol. Mass.429.3951
SMILESOC1CCN(C1)c1ncccc1-c1ccc2c3[nH]ncc3c(=O)n(CC(F)(F)F)c2c1
Structure
n/a