Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMethylated AKR1B10 K125R/V301L (AKME2MU)
LigandBDBM200221
Substrate/Competitorn/a
Meas. Tech.IC50-Activity Assay (AR)
pH7±n/a
IC50 80± 0 nM
Commentsextracted
Citation Cousido-Siah, ARuiz, FXFranflík, JGiménez-Dejoz, JMitschler, AKamlar, MVesely´, JAjani, HParés, XFarrés, JHobza, PPodjarny, AD IDD388 Polyhalogenated Derivatives as Probes for an Improved Structure-Based Selectivity of AKR1B10 Inhibitors ACS Chem Biol11:2693-2705 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Methylated AKR1B10 K125R/V301L (AKME2MU)
Name:Methylated AKR1B10 K125R/V301L (AKME2MU)
Synonyms:n/a
Type:Protein
Mol. Mass.:36066.71
Organism:Homo sapiens (Human)
Description:Methylated form of AKR1B10 with mutations K125R and V301L; 4XLJ; 4XLK; 4XM9; 4XLM; 4XMJ; 4XZL; 4WEV
Residue:316
Sequence:
MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQ
EKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD
DLFPRDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKP
VTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK
HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACN
LLQSSHLEDYPFNAEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM200221
NameBDBM200221
Synonyms:2-(5-chloro-2-(((perbromophenyl)methyl)carbamoyl)phenoxy)acetic acid | MK204
TypeSmall organic molecule
Emp. Form.C16H9Br5ClNO4
Mol. Mass.714.22
SMILESOC(=O)COc1cc(Cl)ccc1C(=O)NCc1c(Br)c(Br)c(Br)c(Br)c1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a