Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAnthranilyl-CoA synthetase PqsA (PqsA)
LigandBDBM205461
Substrate/Competitorn/a
Meas. Tech.PqsA Spectrophotometric Assay
pH8±n/a
Ki 109±18 nM
Commentsextracted
Citation Ji, CSharma, IPratihar, DHudson, LLMaura, DGuney, TRahme, LGPesci, ECColeman, JPTan, DS Designed Small-Molecule Inhibitors of the Anthranilyl-CoA Synthetase PqsA Block Quinolone Biosynthesis in Pseudomonas aeruginosa. ACS Chem Biol11:3061-3067 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Anthranilyl-CoA synthetase PqsA (PqsA)
Name:Anthranilyl-CoA synthetase PqsA (PqsA)
Synonyms:n/a
Type:Protein
Mol. Mass.:56603.82
Organism:Pseudomonas aeruginosa (Gram- Bacteria)
Description:n/a
Residue:517
Sequence:
MSTLANLTEVLFRLDFDPDTAVYHYRGQTLSRLQCRTYILSQASQLARLLKPGDRVVLAL
NDSPSLACLFLACIAVGAIPAVINPKSREQALADIAADCQASLVVREADAPSLSGPLAPL
TLRAAAGRPLLDDFSLDALVGPADLDWSAFHRQDPAAACFLQYTSGSTGAPKGVMHSLRN
TLGFCRAFATELLALQAGDRLYSIPKMFFGYGMGNSLFFPWFSGASALLDDTWPSPERVL
ENLVAFRPRVLFGVPAIYASLRPQARELLSSVRLAFSAGSPLPRGEFEFWAAHGLEICDG
IGATEVGHVFLANRPGQARADSTGLPLPGYECRLVDREGHTIEEAGRQGVLLVRGPGLSP
GYWRASEEQQARFAGGWYRTGDLFERDESGAYRHCGREDDLFKVNGRWVVPTQVEQAICR
HLPEVSEAVLVPTCRLHDGLRPTLFVTLATPLDDNQILLAQRIDQHLAEQIPSHMLPSQL
HVLPALPRNDNGKLARAELRHLADTLYHDNLPEERAC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM205461
NameBDBM205461
Synonyms:Salicyl-AMSN (4)
TypeSmall organic molecule
Emp. Form.C17H18N7O7S
Mol. Mass.464.433
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](CNS(=O)(=O)[N-]C(=O)c2ccccc2O)[C@@H](O)[C@H]1O |r|
Structure
n/a