Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptosis regulator Bcl-2
LigandBDBM144875
Substrate/Competitorn/a
Meas. Tech.Time Resolved-Fluorescence Resonance Energy Transfer (TR-FRET) Assay
Temperature298.15±n/a K
Ki 0.147±n/a nM
Commentsextracted
Citation Bruncko, MDing, HDoherty, GAElmore, SWHasvold, LHexamer, LKunzer, ARMantei, RAPark, CSong, XSouers, AJSullivan, GMTao, ZWang, GTWang, LWang, XWendt, MD Apoptosis-inducing agents for the treatment of cancer and immune and autoimmune diseases US Patent US9303025 Publication Date 4/5/2016
More Info.:Get all data from this article,  Assay Method
 
Apoptosis regulator Bcl-2
Name:Apoptosis regulator Bcl-2
Synonyms:Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | Bcl-2 Protein
Type:Homodimer or heterodimer
Mol. Mass.:26269.11
Organism:Homo sapiens (Human)
Description:P10415
Residue:239
Sequence:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM144875
NameBDBM144875
Synonyms:US8952157, 57 | US9303025, 57
TypeSmall organic molecule
Emp. Form.C45H50ClF3N6O6S
Mol. Mass.895.428
SMILESCN1CCC(CC1)Nc1ccc(cc1[N+]([O-])=O)S(=O)(=O)NC(=O)c1ccc(cc1Oc1cccc(c1)C(F)(F)F)N1CCN(CC2=C(CC(C)(C)CC2)c2ccc(Cl)cc2)CC1 |t:49|
Structure
n/a