Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine kinase receptor A (TrkA)
LigandBDBM226898
Substrate/Competitorn/a
Meas. Tech.Cell Based Assay
Temperature310.15±n/a K
IC50 13.6±n/a nM
Commentsextracted
Citation Bagal, SKCui, JJGreasley, SELunney, EAMcAlpine, IJNagata, ANinkovic, SOmoto, KSkerratt, SEStorer, RIWarmus, JS Tropomyosin-related kinase inhibitors US Patent US9328096 Publication Date 5/3/2016
More Info.:Get all data from this article,  Assay Method
 
Tyrosine kinase receptor A (TrkA)
Name:Tyrosine kinase receptor A (TrkA)
Synonyms:NTRK1 | Tyrosine kinase receptor A
Type:Protein
Mol. Mass.:39939.20
Organism:Homo sapiens (Human)
Description:Human his-tagged TrkA cytoplasmic domain (441-796 aa)
Residue:356
Sequence:
KCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDA
CVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQRE
AELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPG
PLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDY
YRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCI
TQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM226898
NameBDBM226898
Synonyms:US9328096, 586
TypeSmall organic molecule
Emp. Form.C27H19Cl2N7O2
Mol. Mass.544.391
SMILESClc1cc(Cl)c(cc1C(=O)Nc1cc(nn1-c1ccccc1)C(=O)NCc1ncccn1)-c1ccccn1
Structure
n/a