Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOlfactory receptor class A 1 (ORA1)
LigandBDBM231636
Substrate/Competitorn/a
Meas. Tech.Functional Calcium Imaging Assay
pH7.4±n/a
EC50 1.918e+5± 3.98e+4 nM
Commentsextracted
Citation Behrens, MFrank, ORawel, HAhuja, GPotting, CHofmann, TMeyerhof, WKorsching, S ORA1, a zebrafish olfactory receptor ancestral to all mammalian V1R genes, recognizes 4-hydroxyphenylacetic acid, a putative reproductive pheromone. J Biol Chem289:19778-88 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Olfactory receptor class A 1 (ORA1)
Name:Olfactory receptor class A 1 (ORA1)
Synonyms:n/a
Type:Protein
Mol. Mass.:34536.30
Organism:Danio rerio (Zebrafish)
Description:Q597G5
Residue:316
Sequence:
MDLCVTIKGVSFLLQAGLGILANALVLLAYAHIRLAEARLQPVDAILCHLALVDLLLLLT
RGVPQTMTVFGMRNLLDDTGCKVVIYTYRIARALSVCITCMLSVFQAVTVAPAAGPLLSG
VKARLPQLLAPTFAALWFINMAVCIAAPFFSVAPRNGTVPPFTLNLGFCHVDFHDNLSYV
LNGVAVSVRDFAFVGAMLASSGFILLLLHRHRRQVRAVRRSQGSTMETRAARTVLMLVIL
YSVFFGIDNVIWIYMLTVAQVPPVVAHMRVFFSSCYASLSPFLIISSNRKLKARMVCATS
EQERQAEDGKNSSGKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM231636
NameBDBM231636
Synonyms:3-(4-Hydroxyphenyl)-propionic acid
TypeSmall organic molecule
Emp. Form.C9H10O3
Mol. Mass.166.1739
SMILESOC(=O)CCc1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a