Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNuclear receptor ROR-gamma (RORC)
LigandBDBM292839
Substrate/Competitorn/a
Meas. Tech.transient transactivation assay
IC50<100±n/a nM
Citation Argiriadi, MABreinlinger, ECCusack, KPHobson, ADPotin, DBarth, MAmaudrut, JPoupardin, OMounier, LKort, ME Nuclear receptor modulators US Patent US10106501 Publication Date 10/23/2018
More Info.:Get all data from this article,  Assay Method
 
Nuclear receptor ROR-gamma (RORC)
Name:Nuclear receptor ROR-gamma (RORC)
Synonyms:NR1F3 | Nuclear receptor ROR-gamma | Nuclear receptor subfamily 1 group F member 3 | RAR-related orphan receptor C (RORc) | RORC | RORG | RZRG | Retinoid-related orphan receptor-gamma | Retinoid-related orphan receptor-gamma (RORc)
Type:Enzyme Catalytic Domain
Mol. Mass.:58218.40
Organism:Homo sapiens (Human)
Description:P51449
Residue:518
Sequence:
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQR
CNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS
GSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPG
LGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIF
SREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEV
VLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALY
TALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHV
ERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM292839
NameBDBM292839
Synonyms:US10106501, Example FJ
TypeSmall organic molecule
Emp. Form.C25H25Cl2F3N4O2
Mol. Mass.541.393
SMILESCc1nc(cc2n(C)c(Cc3c(Cl)ccc(C(=O)N4CCN(CC4)C4COC4)c3Cl)cc12)C(F)(F)F
Structure
n/a