Target
Carbonic anhydrase
Ligand
BDBM26981
Substrate
n/a
Meas. Tech.
ChEMBL_158311
pH
7.5±n/a
Temperature
293.15±n/a K
Ki
9000000±n/a nM
Citation
 Del Prete, SVullo, DDe Luca, VCarginale, Vdi Fonzo, POsman, SMAlOthman, ZSupuran, CTCapasso, C Anion inhibition profiles of a-, - and -carbonic anhydrases from the pathogenic bacterium Vibrio cholerae. Bioorg Med Chem 24:3413-7 (2016) [PubMed]  Article
Target
Name:
Carbonic anhydrase
Synonyms:
Beta-carbonic anhydrase | VchβCA
Type:
Protein
Mol. Mass.:
25222.79
Organism:
Vibrio cholerae
Description:
A0A086SLX8
Residue:
222
Sequence:
MPEIKQLFENNSKWSESIKAETPEYFAKLAKGQNPDFLWIGCADSRVPAERLTGLYSGELFVHRNVANQVIHTDLNCLSVVQYAVDVLQVKHIIVCGHYGCGGVTAAIDNPQLGLINNWLLHIRDYYLKHREYLDQMPAEDRSDKLAEINVAEQVYNLANSTVLQNAWERGQAVEVHGFVYGIEDGRLEYLGVRCASRSAVEDNYHKALEKILNPNHRLLCR
  
Inhibitor
Name:
BDBM26981
Synonyms:
CHEMBL1644695 | I- | IODIDE | POTASSIUM IODIDE | iodide | iodide ion
Type:
Ion
Emp. Form.:
I
Mol. Mass.:
126.90502
SMILES:
[I-]
Structure:
Search PDB for entries with ligand similarity: