Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5'-AMP-activated protein kinase catalytic subunit alpha-2
LigandBDBM327895
Substrate/Competitorn/a
Meas. Tech.enzyme-linked immunosorbent assay
EC50 3000±n/a nM
Citation Goff, DPayan, DSingh, RShaw, SCarroll, DHitoshi, Y AMPK-activating heterocyclic compounds and methods for using the same US Patent US10377742 Publication Date 8/13/2019
More Info.:Get all data from this article,  Assay Method
 
5'-AMP-activated protein kinase catalytic subunit alpha-2
Name:5'-AMP-activated protein kinase catalytic subunit alpha-2
Synonyms:ACACA kinase | AMP-activated protein kinase, alpha-2 subunit | AMPK | AMPK subunit alpha-2 | AMPK-alpha2 | AMPK2 | Acetyl-CoA carboxylase kinase | Hydroxymethylglutaryl-CoA reductase kinase | PRKAA2
Type:Enzyme
Mol. Mass.:62331.02
Organism:Homo sapiens (Human)
Description:P54646
Residue:552
Sequence:
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQR
SGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFF
EMCASLITTLAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM327895
NameBDBM327895
Synonyms:(4-(4- fluorobenzyl)piperazin- 1-yl)(6-(4- phenoxyphenylamino) pyridin-3-yl)methanone | US10377742, Compound 34 | US9663496, Compound 34
TypeSmall organic molecule
Emp. Form.C29H27FN4O2
Mol. Mass.482.5487
SMILESFc1ccc(CN2CCN(CC2)C(=O)c2ccc(Nc3ccc(Oc4ccccc4)cc3)nc2)cc1
Structure
n/a