Reaction Details |
 | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM497384 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Pharmacological Activity Assay |
---|
Ki | 17.3±n/a nM |
---|
Citation | Godek, DM; Howard, HR; Stewart, AM Cycloalkyl-diamines for the treatment of pain US Patent US11007200 Publication Date 5/18/2021 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM497384 |
---|
Name | BDBM497384 |
Synonyms: | US11007200, Example 2a |
Type | Small organic molecule |
Emp. Form. | C20H32ClN3 |
Mol. Mass. | 349.941 |
SMILES | CN[C@@]1(CCCC[C@@H]1NCCCN1CCCC1)c1ccccc1Cl |
Structure |  |
n/a |
---|