Reaction Details |
 | Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM497391 |
---|
Substrate/Competitor | n/a |
---|
Ki | 305±n/a nM |
---|
Citation | Godek, DM; Howard, HR; Stewart, AM Cycloalkyl-diamines for the treatment of pain US Patent US11007200 Publication Date 5/18/2021 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | MAC30 | Meningioma-associated protein 30 | S2R | Sigma-2 receptor | Sigma2 receptor | TMEM97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20857.20 |
Organism: | Homo sapiens (Human) |
Description: | Q5BJF2 |
Residue: | 176 |
Sequence: | MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
|
|
|
BDBM497391 |
---|
Name | BDBM497391 |
Synonyms: | US11007200, Example 2b |
Type | Small organic molecule |
Emp. Form. | C20H32ClN3 |
Mol. Mass. | 349.941 |
SMILES | CN[C@]1(CCCC[C@@H]1NCCCN1CCCC1)c1ccccc1Cl |
Structure |  |
n/a |
---|