Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM497387
Substrate/Competitorn/a
Meas. Tech.Pharmacological Activity Assay
Ki 217±n/a nM
Citation Godek, DMHoward, HRStewart, AM Cycloalkyl-diamines for the treatment of pain US Patent US11007200 Publication Date 5/18/2021
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM497387
NameBDBM497387
Synonyms:US11007200, Example 3b
TypeSmall organic molecule
Emp. Form.C22H28ClFN2
Mol. Mass.374.923
SMILESCN[C@]1(CCCC[C@@H]1NCCCc1ccc(F)cc1)c1ccccc1Cl
Structure
n/a