Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEgl nine homolog 1
LigandBDBM500335
Substrate/Competitorn/a
Meas. Tech.Effect of Compounds on Activities of HIF Prolyl Hydroxylase-2
IC50 800±n/a nM
Citation Liu, DChen, DDeng, BTu, XFang, ZWu, HGu, D Indolizine derivatives and their application in medicine US Patent US11021478 Publication Date 6/1/2021
More Info.:Get all data from this article,  Assay Method
 
Egl nine homolog 1
Name:Egl nine homolog 1
Synonyms:Egl nine homolog 1 (EGLN1) | Hypoxia-inducible factor prolyl hydroxylase 2 (HIF-PH2) | Hypoxia-inducible factor prolyl hydroxylase 2 (HIFPH2) | Prolyl hydroxylase domain-containing protein 2 (PHD2)
Type:Protein
Mol. Mass.:46035.59
Organism:Homo sapiens (Human)
Description:Q9GZT9
Residue:426
Sequence:
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQG
SEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADP
AAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR
PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQL
VSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMV
ACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKF
DRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDS
VGKDVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM500335
NameBDBM500335
Synonyms:US11021478, Example 30
TypeSmall organic molecule
Emp. Form.C19H22N2O5
Mol. Mass.358.3884
SMILESOC(=O)CNC(=O)C1=C(O)C2(CCCCC2)n2c(ccc2C1=O)C1CC1 |c:7|
Structure
n/a