| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Stimulator of interferon genes protein (aa 139-379 H232R) |
|---|
| Ligand | BDBM501361 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | STING SPA Binding Assay |
|---|
| IC50 | <10.00±n/a nM |
|---|
| Citation |  Emanuel, S; Richter, M; Connolly, PJ; Edwards, JP; Wang, G; Thatikonda, SK; Beigelman, L; Zhong, M; Bignan, G Cyclic dinucleotides as sting agonists US Patent US11021511 Publication Date 6/1/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Stimulator of interferon genes protein (aa 139-379 H232R) |
|---|
| Name: | Stimulator of interferon genes protein (aa 139-379 H232R) |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 27090.78 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 241 |
|---|
| Sequence: | LAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRL
YILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCV
LEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPA
DDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDF
S
|
|
|
|---|
| BDBM501361 |
|---|
| Name | BDBM501361 |
|---|
| Synonyms: | US11021511, Compound 5 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25FN10O12P2 |
|---|
| Mol. Mass. | 690.4289 |
|---|
| SMILES | Nc1nc2n(cnc2c(=O)[nH]1)C1OC2COP(O)(=O)OC3C(COP(O)(=O)OC1C2CO)OC(C3F)n1cnc2c(N)ncnc12 |
|---|
| Structure |  |
|---|
| n/a |
|---|
Search and Browse
