Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetStimulator of interferon genes protein [138-378]
LigandBDBM501361
Substrate/Competitorn/a
Meas. Tech.STING SPA Binding Assay
IC50 16.0±n/a nM
Citation Emanuel, SRichter, MConnolly, PJEdwards, JPWang, GThatikonda, SKBeigelman, LZhong, MBignan, G Cyclic dinucleotides as sting agonists US Patent US11021511 Publication Date 6/1/2021
More Info.:Get all data from this article,  Assay Method
 
Stimulator of interferon genes protein [138-378]
Name:Stimulator of interferon genes protein [138-378]
Synonyms:Stimulator of interferon genes protein (aa 138-378)
Type:Enzyme Catalytic Domain
Mol. Mass.:27213.36
Organism:Mus musculus (Mouse)
Description:n/a
Residue:241
Sequence:
LTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRL
YILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCI
LEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPT
DGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDL
I
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM501361
NameBDBM501361
Synonyms:US11021511, Compound 5
TypeSmall organic molecule
Emp. Form.C21H25FN10O12P2
Mol. Mass.690.4289
SMILESNc1nc2n(cnc2c(=O)[nH]1)C1OC2COP(O)(=O)OC3C(COP(O)(=O)OC1C2CO)OC(C3F)n1cnc2c(N)ncnc12
Structure
n/a