Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetStimulator of interferon genes protein [139-379,H232R]
LigandBDBM501364
Substrate/Competitorn/a
Meas. Tech.STING SPA Binding Assay
IC50<10.00±n/a nM
Citation Emanuel, SRichter, MConnolly, PJEdwards, JPWang, GThatikonda, SKBeigelman, LZhong, MBignan, G Cyclic dinucleotides as sting agonists US Patent US11021511 Publication Date 6/1/2021
More Info.:Get all data from this article,  Assay Method
 
Stimulator of interferon genes protein [139-379,H232R]
Name:Stimulator of interferon genes protein [139-379,H232R]
Synonyms:Stimulator of interferon genes protein (aa 139-379 H232R)
Type:Enzyme Catalytic Domain
Mol. Mass.:27090.78
Organism:Homo sapiens (Human)
Description:n/a
Residue:241
Sequence:
LAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRL
YILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCV
LEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPA
DDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDF
S
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM501364
NameBDBM501364
Synonyms:US11021511, Compound 6c
TypeSmall organic molecule
Emp. Form.C21H25FN10O10P2S2
Mol. Mass.722.56
SMILESCO[C@@H]1[C@H]2CO[P@@](S)(=O)O[C@@H]3[C@@H](CO[P@@](S)(=O)O[C@H]1[C@@H](O2)n1cnc2c1nc(N)[nH]c2=O)O[C@H]([C@@H]3F)n1cnc2c(N)ncnc12 |r|
Structure
n/a