Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThioredoxin reductase 1, cytoplasmic
LigandBDBM501861
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50 56.9±n/a nM
Citation Pelcman, BSuna, EStafford, WPriede, M Heteroarylsulfonyl-substituted pyridines and their use in the treatment of cancer US Patent US11028067 Publication Date 6/8/2021
More Info.:Get all data from this article,  Assay Method
 
Thioredoxin reductase 1, cytoplasmic
Name:Thioredoxin reductase 1, cytoplasmic
Synonyms:GRIM-12 | Gene associated with retinoid-IFN-induced mortality 12 protein | KM-102-derived reductase-like factor | TR | Thioredoxin reductase 1 | Thioredoxin reductase 1 (TrxR) | Thioredoxin reductase TR1
Type:Protein
Mol. Mass.:70761.78
Organism:Homo sapiens (Human)
Description:Q16881
Residue:648
Sequence:
MGCAEGKAVAAAAPTELQTKGKNGDGRRRSAKDHHPGKTLPENPAGFTSTATADSRALLQ
AYIDGHSVVIFSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDL
PVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKE
AAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
EETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEK
IYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLA
GIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVV
AQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIY
AIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKA
VEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQ
GFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM501861
NameBDBM501861
Synonyms:US11028067, Example 2
TypeSmall organic molecule
Emp. Form.C10H6ClN3O4S
Mol. Mass.299.69
SMILES[O-][N+](=O)c1ccc(Cl)nc1S(=O)(=O)c1ccccn1
Structure
n/a