Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutathione reductase
LigandBDBM501864
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50>100000000±n/a nM
Citation Pelcman, BSuna, EStafford, WPriede, M Heteroarylsulfonyl-substituted pyridines and their use in the treatment of cancer US Patent US11028067 Publication Date 6/8/2021
More Info.:Get all data from this article,  Assay Method
 
Glutathione reductase
Name:Glutathione reductase
Synonyms:Glutathione reductase
Type:Enzyme
Mol. Mass.:56271.52
Organism:Homo sapiens (Human)
Description:P00390
Residue:522
Sequence:
MALLPRALSAGAGPSWRRAARAFRGFLLLLPEPAALTRALSRAMACRQEPQPQGPPPAAG
AVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDP
KPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELPGRSVIVGAG
YIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKK
TLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVD
EFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPP
IGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQ
GLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM501864
NameBDBM501864
Synonyms:US11028067, Example 5
TypeSmall organic molecule
Emp. Form.C10H8N4O5S
Mol. Mass.296.259
SMILESCOc1ccc(c(n1)S(=O)(=O)c1ncccn1)[N+]([O-])=O
Structure
n/a